DPCstruct | MC54475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 122 ± 21 aa |
| Standard deviation of domain lengths | 21.18 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.83 |
| Pfam Score | 80.00 |
| Assigned Pfam label(s) | PF04860- PF05136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A285GJ29 | 15-109 | CDAEATLNHYQLQALVLVSSMVAGDVFVASPDQERPGCIFSTRLQLIESDRVGNPNGSMDRVDLVEGVEFDGLGSPVAYHVCSGYLV… |
| A0A827P7T3 | 99-250 | IGEEEARAFSREVEAAWKEFAEDDCCCIDVERKRTFTMMIREGVAMHAFNGELFVQATWDTRPSRLFRTQFRMVSPKRISNPNNTSD… |
| A0A6D0NTS8 | 4-122 | None |
| B4CWU6 | 51-173 | None |
| A0A6J4G4J9 | 63-170 | None |
| A0A1A9VKE9 | 305-437 | None |
| A0A447U5T1 | 177-293 | None |
| A0A142WP67 | 161-295 | None |
| A0A379XPD6 | 105-244 | None |
| A0A236MRM7 | 233-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.