DPCstruct | MC54471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 590 |
|---|---|
| Mean domain length (aa) | 181 ± 41 aa |
| Standard deviation of domain lengths | 41.29 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.49 |
| Pfam Score | 90.30 |
| Assigned Pfam label(s) | CL0063- CL0477- CL0382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6IQB3 | 21-202 | NSYYQDLPNGWSVCKLCEISYFERGITFPASAKEASPTGRNIACARTANVQDSFDISNLIYVDKSFMKDNPDKLLKVNDIIVSTANS… |
| A0A7X8DP36 | 4-164 | HITLDGRAKWALGIVTGNNQKFCKSEPIKGYLPIYKGSDITKNGLKETTTFITKEFTKLQQCAPLKLYQAKEKLIYKFISSKLCFYY… |
| U2RBY6 | 121-324 | None |
| A0A7X9YHX1 | 72-263 | None |
| A0A7X9YIK5 | 29-238 | None |
| A0A1C6GV87 | 3-160 | None |
| J0RTI0 | 103-258 | None |
| A0A0E2P5Y1 | 164-328 | None |
| R7BK50 | 543-733 | None |
| A0A2D9EW95 | 25-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.