DPCstruct | MC54469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 315 ± 53 aa |
| Standard deviation of domain lengths | 52.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.51 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0063- PF06634 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6ZYD7 | 15-344 | ALLVKAISDLAKLEGNSKRPVYAIHKWWARRLSSVIRALIIGIFLPEKTSEDDFWKAYYESCDLSGLTILDTFMGGGTCLVEAKKMK… |
| A0A366I4M9 | 2-277 | YELGALGAFVGRTLTNPPDPVAFRKAAEDVLTAAESEDGWMYEARDPSGAKGSIRHLIWSDNLRCPGCNSVVALWDACVSLDPAEIS… |
| A0A7T1MHH9 | 26-309 | None |
| A0A430FA65 | 2-302 | None |
| A0A417Q6R1 | 101-346 | None |
| A0A1V6C8B4 | 126-467 | None |
| A0A847E4S1 | 12-301 | None |
| A0A1V5HYL0 | 52-343 | None |
| A0A450TN59 | 7-367 | None |
| A0A843S3R0 | 2-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.