DPCstruct | MC54461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 81 ± 4 aa |
| Standard deviation of domain lengths | 3.71 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 94.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 32.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0334 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A058Z7I6 | 1-90 | MVLPFDKVKRVLDEACREWDEHIFIAGDSPFQTVSLIGEDQSEVEVVFGPLHGPRRYVFPLSECKILPCDNITSEWLAVLLAQKCAC… |
| A0A6S8B586 | 73-150 | YVLDFGKIKAVLRDLCKDINEHVILPVNSNVLEISEKGENVNVKCEDGSLFSFPRNDCKLLPIEHSSAEELAEYILGK |
| A0A1I3FHC1 | 403-485 | None |
| A0A482SE05 | 53-131 | None |
| A0A812G6E3 | 67-145 | None |
| A0A2M6X267 | 86-162 | None |
| A0A812VS07 | 68-147 | None |
| A0A7S1GMS5 | 77-158 | None |
| A0A7S2RP96 | 285-368 | None |
| T0T2X2 | 31-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.