DPCstruct | MC5446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 69.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03646 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q0VB97 | 3-88 | SNGEILNKNRDYTLDEVKKAADELNKLFKDKSTYVEYEVYGKSKSITIKILDNKTKEIVKEIPPRKLIDMVDKLCELAGIFVDKRA |
| A0A837Y4X2 | 1-74 | MSSQVEQTIQKANKLLEPSQVHLKFELHEKLDEYYVKVVDSKTEAVIREIPPKQWLDFYAAMAEFIGLLVDKSM |
| A0A354I3L1 | 85-195 | None |
| A0A7U1BX55 | 12-101 | None |
| A0A7X9GHX5 | 28-134 | None |
| A0A7D7ZK46 | 16-124 | None |
| D0ICA9 | 22-112 | None |
| A0A7W5GXQ2 | 20-121 | None |
| A0A1V4VSZ5 | 25-130 | None |
| F5YDI8 | 21-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.