DPCstruct | MC54452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 119 ± 12 aa |
| Standard deviation of domain lengths | 11.94 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.98 |
| Pfam Score | 82.61 |
| Assigned Pfam label(s) | PF19278- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C1B3A9 | 1-151 | MARKLGIKRIICPTGAGVTSAIGLIIAPVAVDLSSSLPMALANWDEAEASRLLGDLAGQGAEVVAAAGVPRDAITNSYTVDMRYVGQ… |
| A0A7Y1UVB5 | 47-149 | LSPPRVDIARSINDENELAWAAATTQDAAIDALLAATGSSGSVETLIDVRYAGQSHELTVASRPEDGMKEIGALFHRLHQARNGFAR… |
| H0EM88 | 451-570 | None |
| A0A432QU89 | 70-181 | None |
| A0A7G2M0S1 | 222-335 | None |
| W6YAC2 | 1-105 | None |
| K2S7Q5 | 75-180 | None |
| A0A3P7J841 | 199-315 | None |
| A0A212DNY4 | 32-146 | None |
| A0A2V6TNZ6 | 1030-1160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.