DPCstruct | MC54449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 262 ± 38 aa |
| Standard deviation of domain lengths | 38.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.47 |
| Pfam Score | 74.26 |
| Assigned Pfam label(s) | CL0161- PF05524- CL0198- CL0364- PF00381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9HTW0 | 2-193 | HEQQRLRQALQQTLGDLNRLAERTATLIGKPQAGIFGAHSMLLDDPDLQQAAYTRIAQQCCSAEQAWRQELEAVAADYRALDDDYLR… |
| A0A0W7TQ69 | 265-536 | PNKRQKQIFKAREPLEQEEDGGGAACGLCRETGRCADLKYITAVPASAGLAVGTVRYLRHTQSGLGRAVRSPKEEQEAFENAVREAQ… |
| A0A381ETG7 | 118-350 | None |
| A0A1C6HI28 | 5-261 | None |
| A0A426TYW5 | 16-277 | None |
| A0A0W1A545 | 158-430 | None |
| A0A2N5E221 | 52-389 | None |
| A0A4U1LZH9 | 346-630 | None |
| A0A7X0TV99 | 2-213 | None |
| A0A4U9D6J9 | 32-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.