DPCstruct | MC54445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 95 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 33.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M0AS47 | 27-109 | QSEIDIPLSEKVRQYIYEDPDRLFQKHIRNHPEATFQTIALAYLDGKKWKEISKLFGISVPTLSHFYQRYLKEVAPKIKKSIQ |
| A0A433VIE9 | 1-86 | MTNFDSDYTGRLRRYLESDPDNLFQEAYIENYPEANFAFIAIQVLDRRTWQQISDSLDGIPVPTLGKFYYRWVRQFAPQIRAYLDN |
| A0A6P0HSY5 | 1-82 | None |
| A0A3C0NB59 | 40-140 | None |
| A0A433V6T8 | 23-116 | None |
| A0A7C9U0R5 | 223-314 | None |
| A0A433VBE2 | 102-207 | None |
| A0A846E3N5 | 36-120 | None |
| B4WTY3 | 141-223 | None |
| A0A6P0Z048 | 56-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.