DPCstruct | MC54444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 119 ± 18 aa |
| Standard deviation of domain lengths | 17.68 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 30.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M0AQ39 | 17-130 | QNGTVGTAELANNSVTNQKIANNAVNAAKIQNGTVGTAELANNSVTNQKIANNAVNAAKIQNGTVGTAELANNSVTNAKIANNAVNA… |
| A0A074TMW0 | 11-123 | IKTEHLADNAVTSPKIGVNEVKGTHIAGSAVGNVHLANNAVTSTKISGGAVGTGQLADDAVTSPKIGVNEVKGMHIAGSAVGTVQLG… |
| A0A4R7KTS6 | 94-221 | None |
| A0A2P6BY81 | 124-238 | None |
| A0A1Y6C4J4 | 222-327 | None |
| A0A497P4P6 | 30-137 | None |
| A0A1G1A3U9 | 31-180 | None |
| A0A0F9KJ39 | 125-248 | None |
| A0A2Z4FR47 | 34-166 | None |
| A0A6C2YVX1 | 729-840 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.