DPCstruct | MC54442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 873 |
|---|---|
| Mean domain length (aa) | 142 ± 27 aa |
| Standard deviation of domain lengths | 27.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.70 |
| Pfam Score | 98.05 |
| Assigned Pfam label(s) | CL0023- CL0229- PF12024- PF06001- PF00439 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7Z5I5 | 7-110 | QEAKQLAEKIRPILNALRSHILAGPFQKPVTVDEAPDYYDIIVFPIDLSTMWERLKSNYYVTKSLFIADMMRMFHNCRTYNQQDSYL… |
| U4UA64 | 20-176 | ASGSGIPSAVGQPGVLGQKSKEKLNDHLKACSEILKELFSKKHCTYAWPFYKPVDAEMLGLHDYHDIIKHPMDLGTIKEKLDNREYH… |
| A0A0K0EH23 | 392-658 | None |
| A0A0K0DWW8 | 1177-1351 | None |
| A0A0V0QQZ7 | 13-149 | None |
| A0A0V0QIE6 | 5-158 | None |
| A0A182THV9 | 41-192 | None |
| A0A101MBJ4 | 4-184 | None |
| A0A7S1VD53 | 2-129 | None |
| A0A7M5WJD5 | 852-985 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.