DPCstruct | MC54439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 230 ± 16 aa |
| Standard deviation of domain lengths | 15.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.56 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF14637- PF14638 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4U316 | 3-220 | SRDEQELTTEPTISSNLMKLVNIPMPKSLINSIPDCSIPYRTTVIKGLVDTYIPDMVLQGTTDPKHKWHSELRNNLAMNSQHSLLDQ… |
| A0A060XAD4 | 42-261 | EDAGQDVHRQSDSDTYYKDDQEPDEWQEEVEVPFPGSKLVEHFSKPSIANFGRSLFGGYCTTYVPDFVLQGMPNDDKLRQGLMSELA… |
| A0A1I8HWS1 | 960-1221 | None |
| A0A1I8IL24 | 237-446 | None |
| A0A7R9A4A6 | 730-964 | None |
| A0A2D4Q5F9 | 113-361 | None |
| A0A0B2VV26 | 16-257 | None |
| A0A7J7XFT0 | 525-772 | None |
| A0A182TZC0 | 209-404 | None |
| A0A2G5UCL4 | 826-1071 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.