DPCstruct | MC54437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 319 |
|---|---|
| Mean domain length (aa) | 250 ± 49 aa |
| Standard deviation of domain lengths | 49.07 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.14 |
| Pfam Score | 98.58 |
| Assigned Pfam label(s) | CL0023- CL0743- CL0220- PF03826- PF04435 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5W5C7 | 5-206 | LQAALPDCKITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCTNAMNLAQREFGVPKVLEPEYLASPWLDELSGMTYLS… |
| A0A1I7YZM1 | 12-281 | FRMSSKYQHDKIQKKTFTKWINYHLETHNSSRQVEDLFEDLRDGVLLCHLIEVLTGEALPVHKGRVSKRVHHISNLTTALTVLRRRG… |
| A0A1U8P546 | 8-252 | None |
| A0A2I4D4S6 | 45-239 | None |
| A0A0K0E918 | 382-628 | None |
| A0A821LKI1 | 115-322 | None |
| A0A6P8IAZ9 | 724-907 | None |
| A0A1B0BMH3 | 164-485 | None |
| A0A654HZW7 | 623-916 | None |
| A0A034V9W6 | 41-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.