DPCstruct | MC54435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 103 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7YJS1 | 1-118 | MQCEDPLHSSLWAKISNESQLSLQVKPVVLPNDLALLPLPLFDRRDPRALSLPFVFAVAPDNTTLEAAGAVSSWIGALASYRGANFP… |
| A0A2S7TQF4 | 116-226 | PESALTIGSTPLNLVNDLALLPAPFFDPRDNRKLRLPLVLPVEQTEASMKAAGILASWMGAQAFYRQAEFELLETASPTRHTIILTK… |
| A0A4U9VT66 | 1-106 | None |
| A0A6M5Z5I2 | 1-101 | None |
| A0A7Z0AYB3 | 283-372 | None |
| A0A6N4T2F5 | 658-746 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.