DPCstruct | MC54428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 14.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 29.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7Y0F0 | 3-102 | DYFSELLRKEEMRPACKKCGKIISKLQGRRDHVGAHLNATLLCPFVDCGYSGSEGTMLVHLHRKHGKNLHTLTKEQRSRFEESKKEF… |
| A0A4U5LPD3 | 231-320 | FETSKCSDCGAEVKSASSRRIHVASHINLSFECLIPGCTHQSTTIQFAGHLKQVHGKKVLQLEKEQMFKYKKIRETFREKMKEAVPL… |
| A0A4U5PJJ3 | 46-136 | None |
| A0A4U5PFV3 | 204-298 | None |
| A0A4U5NV08 | 327-419 | None |
| A0A1I7YRF3 | 192-327 | None |
| A0A1I7YBW7 | 109-212 | None |
| A0A1I7Y800 | 390-482 | None |
| A0A1I7Y6R1 | 279-378 | None |
| A0A1I7Y0W9 | 500-601 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.