DPCstruct | MC54427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 130 ± 10 aa |
| Standard deviation of domain lengths | 10.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 32.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7YQD0 | 81-198 | NVFCVEFFFSESCSRLTAFFANSVVLRVINRWKTMDTRGLAVNKILDGIRASPTELAQAGMREVDLNSAKRNILIMVHRNVMELRDI… |
| A0A1I7XZG4 | 1-134 | SFWVEHFLSESCTGFDFHFGPKAAEVTSEVIQRWREMDPRRLPQKTFSGMWINSANTREFTEFDVESADLRLLQKIYRIVADANRKG… |
| A0A1I7YUE0 | 208-350 | None |
| A0A1I7YKP6 | 171-293 | None |
| A0A1I7YK25 | 23-146 | None |
| A0A1I7YDS3 | 114-241 | None |
| A0A1I7Y6U3 | 285-417 | None |
| A0A1I7Y440 | 8-125 | None |
| A0A1I7XYX8 | 67-189 | None |
| A0A1I7XWY1 | 113-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.