DPCstruct | MC5442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 120 ± 5 aa |
| Standard deviation of domain lengths | 4.69 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VNE6 | 77-198 | NVVLTADYGFLSIYPYWGFQGLTSHYANPLAQFDKRAATIARWSESTTPDQMIRKLDRSPWKPPNVFLFRYGADGYTLRLAKDVYPN… |
| A0A0U0SD89 | 3-123 | TADYSFLSYYPYWGFQGLTPHYANPLAQFDKRATQIDSWSGLSTADEFIAALDKLPWQPPTVFLMRHGAHNSYTLRLAQDVYPNQPN… |
| A0A7X9Q2T4 | 50-156 | None |
| A0A7W0YLX0 | 108-232 | None |
| O05765 | 471-594 | None |
| A0A829QA90 | 155-277 | None |
| A0A557YS11 | 691-812 | None |
| A0A4R4P779 | 1-120 | None |
| A0A372JFK6 | 539-655 | None |
| A0A7C5IRB0 | 170-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.