DPCstruct | MC54416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 6.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4XCK1 | 3-66 | IDLTFEFKALSPGQLAETQITSFDVDGHPTVGTIYLDDDANGAGWFIDSTPWESSEFSIQNTEY |
| A0A6I5NI63 | 20-78 | GLPKITLDIRDLPTGQLAEAQLTRFDANGQPIAGTILIDDDANGTGWFIDPTPWESSEF |
| A0A838VTG5 | 18-97 | None |
| A0A6P0THW5 | 471-531 | None |
| A0A6P0TDS3 | 69-127 | None |
| A0A6I5P2B0 | 455-516 | None |
| A0A1V5N2D5 | 205-260 | None |
| A3IQH0 | 52-109 | None |
| L8M290 | 214-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.