DPCstruct | MC5441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 141 ± 23 aa |
| Standard deviation of domain lengths | 22.67 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534UN57 | 295-441 | GGPGSNYATHAIATLAARLRADRESFGLAHALGWNLTKHALAVYGGAPPPRGWQRAGGAALQAHVDAEPHPSIVETPAGRGTIEAYT… |
| A0A0T9F2H7 | 2-125 | AELLAANPGRRGLITANGGYLTKHSFGVYGTEPPSEFRWEDMQPAVDREPTGDGLVEWEGIGTVEAWTTPVNRDGQPEKAFLAVRTP… |
| A0A662CEN1 | 4-132 | None |
| A0A848YNW0 | 107-255 | None |
| A0A3C1VPS4 | 37-189 | None |
| A0A812SR16 | 322-452 | None |
| A0A0E2W994 | 194-331 | None |
| A0A554UZ68 | 572-742 | None |
| A0A2S8BP27 | 132-231 | None |
| A0A523KC99 | 13-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.