DPCstruct | MC54407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 450 ± 93 aa |
| Standard deviation of domain lengths | 93.19 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 72.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.53 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0368- CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419J5I1 | 3-337 | ENAGLSEATMYFIDECTKPYLKEIKSLNVEDVIKELIELLERNKDCPSVVFDRLDGEHRDYKPVVRTLADVSLQAHSYNVARYLIEE… |
| A0A4R0XMQ7 | 25-460 | GVPPSPQYLPVLGYRELIRRTGVEGAVRRIASSLALSFDSEQRDLEPLLQRLAEFVQLMPASESHHHAQPGGLLIHLLEVARYALHF… |
| A0A2K8UHX6 | 41-560 | None |
| G1V902 | 54-521 | None |
| A0A2E6Z873 | 42-618 | None |
| A0A5K8A6B7 | 17-461 | None |
| A0A849SSJ8 | 4-531 | None |
| A0A850RPW4 | 101-580 | None |
| A0A240EIC4 | 19-568 | None |
| Q9L5M2 | 36-653 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.