DPCstruct | MC544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 183 ± 21 aa |
| Standard deviation of domain lengths | 21.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q5TW56 | 3-175 | PEPFSALAPQSLIDSLRSAGTMIYDGNTPPVINGIYLMSPDSCTYDNSPGNSRGQLYTDYKFRFSEQDNNAFTIKLEQKAIPANTVN… |
| A0A3S5F000 | 7-192 | VMTSCSKSDDDKGGNGGIVNNNFSSEVTAVASKETIQKMAAGKATIYGGTTPPEVKLPSGFLFHTGEIVLSHTTLGDKDPIINKVHD… |
| A0A7Y5R6M3 | 27-199 | None |
| A0A7X7FX27 | 49-218 | None |
| A0A2E7UQE9 | 124-293 | None |
| S3BPZ8 | 4-160 | None |
| A0A7X9ADG2 | 4-169 | None |
| A0A1M7PRF6 | 7-238 | None |
| A0A0Q5TV48 | 43-247 | None |
| A0A496M9H6 | 11-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.