DPCstruct | MC5439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 171 ± 27 aa |
| Standard deviation of domain lengths | 27.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5L1L0 | 130-296 | LLKERIEKNAAQLITYEVQSKMGLNKRMVTTLFGLDVSSTEIEITAMSVAKIGFDLDKYFEISINERKKEVVVSLPQPEIIAHDVHP… |
| A0A1G9QJR5 | 1-141 | MVVLEQNFSAMQKTKMSYEFFGKEMTSNSIITYTKTNAQVSYDLNKMKIEVDSINKRLIITELPDAQIRITPSVEIQSLDDSFFNRI… |
| A0A6L9IHI8 | 63-252 | None |
| A0A2P6C584 | 14-213 | None |
| A0A358SLI1 | 37-256 | None |
| A0A3D3EIT1 | 12-199 | None |
| A0A7Y3A8V6 | 19-193 | None |
| A0A6B3URV7 | 94-275 | None |
| A0A3E0NNE5 | 254-408 | None |
| A0A7C6G8L9 | 7-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.