DPCstruct | MC54381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 4.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 56.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B8ZMI2 | 54-118 | QTSEGIADKVYFLPITPYFVEEVIKKEQPDGILLAFGGQTALNCGTELYLSGTLAKYGVQVLGTS |
| A0A817K4A7 | 980-1038 | FCEQITDTHVLPVIREERPYGMLLSFGERTALHCGIRLHEENMLAAYLCNILGEQNIFI |
| A0A7J8E0K1 | 441-505 | None |
| A0A2G8KKI3 | 435-499 | None |
| A0A6J8BYV8 | 546-610 | None |
| A0A813N6G0 | 249-303 | None |
| A0A817MB13 | 1-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.