DPCstruct | MC5438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 149 ± 24 aa |
| Standard deviation of domain lengths | 24.06 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3CJG4 | 1-137 | MEYHYNYNDIIVVNIQPNGEIQWTSRIPKRQETINDGGYYSSYAMAIVRDKICFVYNENPKNFGARKNNRRYGFNGSRSVLALTEVG… |
| A0A4Q3WBT3 | 2-165 | DLISEYYRLDVITSYNPSTHTTTTTYRYTYGDIVNTNISADGKATFTRIPKNQKLTNSDIFLGYYPIVYGDKLVLLYNDDKDNVERD… |
| A0A1Z9P3M9 | 292-442 | None |
| A0A819B4N7 | 202-306 | None |
| A0A7W1PXU0 | 5-142 | None |
| A0A6G8CDG3 | 95-231 | None |
| A0A7L4ZPE2 | 88-278 | None |
| A0A842PXU4 | 30-150 | None |
| A0A090VTF0 | 163-303 | None |
| S7X3R5 | 3-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.