DPCstruct | MC54378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 140 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.18 |
| Pfam Score | 88.89 |
| Assigned Pfam label(s) | CL0433- CL0666 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6L737 | 296-439 | VIALDKNEGIYVMNTTTGEVRTVIGEPYMLKEHEVLWEKDLSPDVEELLACPTGCCRCSERDPNFTSSRAKHRIIRFNVQHNAAVQI… |
| A0A060XRA4 | 346-492 | IPLDENEGIYVRDIKTGKVRAVIGHTYMLTQDEELWAKNLPQNVETLLTSTKDPLADRSDRRKEVEMTARDKTEVVSYRVPHNAAVQ… |
| A0A818X997 | 383-507 | None |
| A0A267FM30 | 384-531 | None |
| A0A2H1BVF2 | 21-172 | None |
| A0A813UIZ2 | 386-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.