DPCstruct | MC54376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 220 ± 27 aa |
| Standard deviation of domain lengths | 27.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818JY07 | 11-220 | LLNKSKFLETLNEDQIQYINANDIRSNKKILTTISDVDTILERTYFNDNVILWYSSDNMKLEREDEWRQTYQELLLELPRCEPRRKL… |
| A0A175W469 | 376-593 | MSIVQKHQERIKFADAMVNKGARFVGHDIKALNNLIMEQGRNDTYVLYFNDAVQVAQPTRWDDNRRLIVELLESKSGDLVIICDCDL… |
| A0A820SIH2 | 68-322 | None |
| A0A817NXN7 | 1-167 | None |
| A0A817S665 | 776-1003 | None |
| A0A820XW78 | 369-553 | None |
| A0A815RQM4 | 1-166 | None |
| A0A820SF51 | 303-533 | None |
| A0A2N0R880 | 219-467 | None |
| A0A813T2E7 | 71-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.