DPCstruct | MC54375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 184 ± 35 aa |
| Standard deviation of domain lengths | 34.69 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03455 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818JJN9 | 1-272 | MFPKKPFKVLKQSLDEIESQVLNTYQQRLYDLRTRLKRNRNDFELRIQMIQLERNMETRIRDVFLRFMCTCFYGYKQFLRPILRRPN… |
| A0A077YZ52 | 528-681 | RRPAKLLKQQLQDLLGKVGQVDFKTTKARKTQNFLPVEVDLGLQQKRKKLELEIQETFLRFMATIMKDYHLYLRPIKSAPSIGSTDL… |
| A0A1S3PW28 | 380-548 | None |
| A0A023FSK5 | 100-325 | None |
| A0A7I4KG27 | 512-672 | None |
| A0A3M0IP40 | 139-311 | None |
| A0A2I4DC49 | 272-416 | None |
| A0A3P6Q7F9 | 2-186 | None |
| A0A7F5RC52 | 152-354 | None |
| A0A3Q3MHX7 | 77-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.