DPCstruct | MC54354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.18 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354AYR0 | 109-188 | NSAIDDHVEVIVVPNTSYQLLYGTVQPSGGSSVSFVVQADGNNYQLTADCNQGLLNGQQPQSSQEAELLNAACQVAYGSV |
| A0A2P7MVD9 | 1-94 | MATLATAAIINDAVDNAVSSNATYIVVPNTNYQLLYGTVQPSGSNSVSFVMQANGSNYQLTANCNQGTINGQEPSNAEEAELLNAAC… |
| A0A4P5VKB5 | 300-374 | None |
| A0A4P5VGC8 | 112-191 | None |
| A0A6N2EFG9 | 1-76 | None |
| A0A4P7ZSI5 | 147-222 | None |
| B5INU4 | 271-349 | None |
| Q0IB89 | 89-164 | None |
| A0A2T1EUN4 | 241-318 | None |
| A0A7T1IDR0 | 138-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.