DPCstruct | MC5435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 108 ± 20 aa |
| Standard deviation of domain lengths | 19.56 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.94 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF09805- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3B6J3 | 1-110 | MRLLTHNMLSSNIKGVTNGFPLGIEVVKVVEKQVELNADFLKNMFHKIDWKGLVDGSRAMGYFELPGEPPETSALESEEFLSKFHHA… |
| A0A5B7E4V4 | 12-105 | RMKLMTHNMLTSKGMKNVKEGFPLKIQAEEMRNVDIDYDRDFITRMIPKLDWKALVFAAQCVGHKEDLPDTLPEGYENDNELLKRLH… |
| A0A0G4ICE5 | 61-176 | None |
| A0A669QH18 | 1-90 | None |
| A0A1Q9N5Z9 | 1-146 | None |
| U6N0Q3 | 118-248 | None |
| A0A4D9A948 | 1-78 | None |
| A0A5Q3FQ77 | 230-350 | None |
| A0A3M9Y0G4 | 278-410 | None |
| A0A1V2LQI3 | 9-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.