DPCstruct | MC54348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 103 ± 16 aa |
| Standard deviation of domain lengths | 15.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B3A900 | 1-104 | MGKILIPGGGGGADLDVITATAPDVRKNKVIVDKDGEPLAGVMNEQAGGTFTPGTSDRVLVPANTFVTSAIIMKGDPNLIAGNIKKN… |
| A0A162JEL5 | 99-182 | KGQGNAVESQVLGGATFSNSDGKLRTGSMSNNGAISGTITNQGQSISIPEGYTKGGSIIAKFANLIASNIKKDVNIGSIIGTLD |
| A0A841SPL1 | 645-730 | None |
| A0A395YEZ9 | 1-138 | None |
| A0A349YMC0 | 194-277 | None |
| A0A0M6WYC7 | 177-277 | None |
| G4Q4H5 | 1-120 | None |
| A0A1S8TU87 | 242-344 | None |
| A0A662RA25 | 1-116 | None |
| A0A401HW24 | 1026-1139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.