DPCstruct | MC54346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Standard deviation of domain lengths | 10.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1XAW8 | 1-103 | PLGGWNPYVVSAQRFTLKTSTGKNYPCISSSVPPHLLRGTSGQKSVEVTDILFDAGFESREEAMSYGVLPGDTIVPYAETIKTANGK… |
| A0A379T7N6 | 16-133 | AHMDEVGFMVRSISGEGAIDVLPVGNVRMAARQLQPVRITTREECKIPGLLEGERSGNEVSGLRVDIGARSHDEVIQAGIRPGDRVT… |
| A0A2D6QZ83 | 157-267 | None |
| A0A376TZR3 | 120-253 | None |
| A0A3S4JT59 | 1-102 | None |
| A0A812PWJ3 | 440-541 | None |
| A0A1W9P3U8 | 59-174 | None |
| A0A832M2W0 | 64-184 | None |
| A0A7W0QN93 | 226-339 | None |
| A0A2V8VKR4 | 179-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.