DPCstruct | MC54345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 363 ± 41 aa |
| Standard deviation of domain lengths | 40.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 32.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S4VLB6 | 33-388 | GRPIDGPENDGKPVSRLRNPLPCLVIFVHGVNSEGEWYNDAERHLCAGGNDRLGRWGTGAELRTSVEKEDDPNYTYDIHRPLKRTRP… |
| A0A1I4NT12 | 24-376 | AKPLKDKIVEVRHNLPGSIILVHGVNDVGTSYEAVESGLCAGLAERLCGQLTPAKYSNPTVADREKVEDDPDAVFFKRKVTEATHSP… |
| A0A7T0DUR3 | 134-508 | None |
| A0A8A8VCB0 | 2-384 | None |
| A0A379DMF4 | 29-397 | None |
| A0A509CYD4 | 37-358 | None |
| A0A430HC77 | 32-350 | None |
| W0VF87 | 25-437 | None |
| A0A0P9SHL6 | 26-452 | None |
| A0A830D9W5 | 38-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.