DPCstruct | MC54344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 785 |
|---|---|
| Mean domain length (aa) | 192 ± 50 aa |
| Standard deviation of domain lengths | 49.78 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 80.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.00 |
| Pfam Score | 85.40 |
| Assigned Pfam label(s) | CL0063- CL0479- CL0123- PF13224- CL0248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376ZVB3 | 44-210 | NAITLPVCGRDVKFTLEVLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQTPAFGRRVSGVIEIADGSRRRKAAALTE… |
| A0A7V1Q0T3 | 84-280 | SVQVPHADGEPTAPTIIAIPVGSIIPNRNQPRKVFEDGSLRSLAESIRADGVMQPILVRPGSGSGSTGGRYELIAGERRWRAAKIAG… |
| A0A7W5HUS1 | 2-206 | None |
| A0A7M7N1A7 | 51-305 | None |
| A0A7M7HL81 | 130-391 | None |
| A0A448EH90 | 4-229 | None |
| A0A843FH83 | 5-178 | None |
| H9UIK2 | 23-275 | None |
| A0A2W7PNM5 | 3-154 | None |
| I0X6M5 | 26-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.