DPCstruct | MC5434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 276 ± 35 aa |
| Standard deviation of domain lengths | 34.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6KA13 | 1-240 | MTANNNVPSQKWPENLIKLSEYLFENSQIGSTRPFRHRCVNLRTQEMFDNLVDLYAQMFMAQWHHYTRFMESFPPPPGVSPQIYAAR… |
| A0A1Q3B5L2 | 1-338 | MASSNPKESEETVKATPKAPVPTKSSAASSPPPKSAAIGRARTEYPREPDMIYTAFEKPKDDVTPIGNKTMELSLKLEGKLGYFLPR… |
| A0A2U1MB28 | 1-233 | None |
| A0A5N6LKK9 | 88-357 | None |
| A0A7J6WQY4 | 3-237 | None |
| A0A5P1EDT3 | 246-580 | None |
| A0A1R3IJS3 | 2-292 | None |
| A0A0S3RJ74 | 704-999 | None |
| A0A4D6LDC9 | 1-260 | None |
| A0A2V0R9Z3 | 1-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.