DPCstruct | MC54336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 4.29 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5WQX3 | 449-514 | GVSLGAGPCAAYDLAEPFGVLDLADLSAFVVAFLTGDLSADFAEPFGTLNGDDISAFVQQFNQGCP |
| A0A2E2N457 | 373-437 | VFSFVYACSAADLGMPFGQLDGADAVAFLQLYGAQDPAADLAAPFGTWDNSDYIVFLQLFGAGCP |
| A0A3M2CLW6 | 20-79 | None |
| A0A3M2CI56 | 345-402 | None |
| A0A3M2CFK5 | 182-251 | None |
| A0A3M2C5G0 | 164-225 | None |
| A0A2E2NAR3 | 952-1017 | None |
| A0A2E2NA53 | 1066-1137 | None |
| A0A2E2N886 | 211-280 | None |
| A0A2E2NC72 | 738-801 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.