DPCstruct | MC54332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 172 |
|---|---|
| Mean domain length (aa) | 150 ± 27 aa |
| Standard deviation of domain lengths | 27.21 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.01 |
| Pfam Score | 93.93 |
| Assigned Pfam label(s) | PF10635- PF19294- PF02457 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4S3A1 | 485-667 | EQLMARLAREAPAGIVRTLTQAVEHLISNAHGGCALAIAPKKAFFDLRTNGIVDYQVVDRDEHWCQGYMSSRVEGTNVRRRSFADAV… |
| A0A7X7R5H5 | 3-133 | LETVDFLSNRKIGALITVERNINLSAFISKAMMINAPVSSELLASIFIPTTPLHDGAVIIRNNSILCAKAYYPSTERTDLPLHFGTR… |
| U1R6B9 | 122-291 | None |
| B7VPJ6 | 37-201 | None |
| V4Y9T1 | 118-273 | None |
| A0A7J4JAZ6 | 55-200 | None |
| A0A139RKQ2 | 67-217 | None |
| A0A0G4H0D2 | 260-449 | None |
| A0A0G4HC97 | 11-186 | None |
| A0A0G4HII4 | 34-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.