DPCstruct | MC54324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 198 ± 10 aa |
| Standard deviation of domain lengths | 9.73 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5YH06 | 1-211 | MRKNIRFPLKMEYNVEVRTLEELRENFSIERVLIYVANGKLITWLRDRNINDIADKIENLDENDSEIINQIFEIFNIKYYIDEYNDI… |
| A0A348N5H1 | 3-195 | KKMRFPLVFKNGVEIRSIDDLKDNFSIEDILNYYLDGRLSIWLRDRYKEDIADKIDSLDQNDEELVHKICDLFEVEHVDVKIDINEL… |
| N1ZSU9 | 1-210 | None |
| A0A173ZL10 | 1-208 | None |
| A0A848BY66 | 3-187 | None |
| A0A416YVA2 | 2-208 | None |
| A5Z9R4 | 1-201 | None |
| A0A346AY05 | 1-196 | None |
| A0A1M6QXL1 | 3-187 | None |
| A0A1M6QXX1 | 1-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.