DPCstruct | MC5432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 64.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3B1Q5 | 1-100 | MEENEKLKIEIDALKKFFSIFSNSSAKLENLLGLQRCVFDKAGLGSQEMKNVKHFKNFFVKKNEPQICCNYCGRLGHISTSCIYRNN… |
| A0A1Q3AY98 | 47-147 | KENRNLKEEIEALKRTFSKFSNSSEKLENLLGMQRCVFDKAELGYEEMNNVKLYQTFFERKERIEKEKVEKVQIKKKIVKTSCGYCG… |
| A0A1Q3C746 | 101-221 | None |
| A0A1Q3C2J4 | 102-195 | None |
| A0A1Q3BNK3 | 46-144 | None |
| A0A1Q3DDZ6 | 17-115 | None |
| A0A1Q3D6N7 | 67-202 | None |
| A0A1Q3D3L1 | 34-128 | None |
| A0A1Q3D285 | 42-154 | None |
| A0A1Q3CHY3 | 95-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.