DPCstruct | MC5431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 98 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D2KXP3 | 4-90 | CGENVSDYDMIEKTLSTFHPGNIVLQQQYRANGYTRYSKLMEVLLVAEQNNELVMMNHQTRPTGAAPFPEANVASSSQNNGRGRGRG |
| A0A1Q3B059 | 1-97 | MLFKIVSQLKMCGEVITEDMLLEKTYRTFHASNVILQQQYRLHGFKKYRELIGSLLIAEQNNELLLQNYESRPTGSAPLPEVNATYS… |
| A0A1U8FJL6 | 54-155 | None |
| A0A811M9M0 | 57-148 | None |
| A0A2G9IB13 | 1-103 | None |
| A0A6N2ADZ1 | 75-178 | None |
| A0A811PTX9 | 9-96 | None |
| A0A6J0KM76 | 8-109 | None |
| A0A1S3XE75 | 54-150 | None |
| A0A2G9I7H6 | 71-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.