DPCstruct | MC54306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 252 ± 57 aa |
| Standard deviation of domain lengths | 57.09 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090KQ74 | 4-190 | SLTPKNAREVVGVVEMKGNTDIDNVAKVAVITNPQVTGTYFPSLDKATAEKMEQLFKTFVPSTFSISLHSLIASTPKKEAPAGAQLN… |
| A0A2V9SFQ5 | 1-189 | MANTEWPLFVDEGSSTYYLAVGQQWLTANKLEGQWSATKKLPPEMSKVPQDKQWSALKKLIPPPANAKGVTPDIFYSDKPAEVILFD… |
| A0A7Y3B280 | 12-303 | None |
| A0A7W8J5I3 | 29-203 | None |
| A0A7W8IXX7 | 79-259 | None |
| A0A538SUQ9 | 6-277 | None |
| A0A0W1GQC1 | 65-275 | None |
| A0A4R7RGD0 | 3-309 | None |
| A0A3D3NWY4 | 1-315 | None |
| A0A2V6EC26 | 2-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.