DPCstruct | MC5430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 135 ± 20 aa |
| Standard deviation of domain lengths | 20.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P80353 | 4-97 | CRRQFQQHQHLRACQRYLRRRAQRGEQRGPALRLCCNQLRQVNKPCVCPVLRQAAHQQLYQGQIEGPRQVRRLFRAARNLPNICKIP… |
| A0A1Q3AYD7 | 4-148 | LALLLATFTVLLLVTNASIYRTTIEIDEENPRRGQQSCREQIQRQQHLNDCQQHLVQESQESGSSWGQGRGRRDDQQQQHLQRCCEQ… |
| A0A1R3JMW3 | 1-142 | None |
| A0A166AHT8 | 20-138 | None |
| B9RPN9 | 38-172 | None |
| A0A835LM37 | 5-104 | None |
| A0A4Y7IBL7 | 8-149 | None |
| A0A1R3HNS3 | 140-257 | None |
| Q5IUG1 | 13-142 | None |
| A0A5C7IFM5 | 34-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.