DPCstruct | MC543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 10.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 20.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8I8I5 | 19-120 | HPEDIEDFSKLLPYGKVFELISNDGDYITIAYGSKRYRVRPDLWKPVEGVGYHVGEQVLVNGRKGVIEEIGWHFNRKSPFFLLSIEG… |
| A0A250FNE9 | 12-111 | DNSGIEMFEALNPQGKLFTILEDLSTYYKISYGDKAFIIRKEAMKVIEGSFLEIGTLVSVVASGKQAIIKDRYWHFKDSKPFYILLG… |
| A0A2P8D7E1 | 25-132 | None |
| A0A3A6J7I3 | 72-180 | None |
| A0A5B9PA92 | 61-178 | None |
| A0A518GFD6 | 31-145 | None |
| D1AJ68 | 191-298 | None |
| A0A7T3RD43 | 16-108 | None |
| A0A8B2DDG6 | 2-97 | None |
| A0A6L4A6M8 | 46-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.