DPCstruct | MC54296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 130 ± 8 aa |
| Standard deviation of domain lengths | 8.22 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 61.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803LI74 | 303-431 | EHDLSVLDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFKVAETPQDNAEEVETYARYKYPTMTKTL… |
| A0A820IE86 | 1-135 | YIIAVEHDLSVLDYLLDFICILYGSPGHYSVATMTFSVRENINTFLEGFIRTENLRFLDVGLTFKVVERVSKEEVRRLSTYYYPAMK… |
| A0A812JG73 | 500-629 | None |
| A0A4T0R1N0 | 804-923 | None |
| A0A0E0M7X9 | 6-124 | None |
| A0A5J4WSZ1 | 32-183 | None |
| A0A818GLJ3 | 279-413 | None |
| A0A1Y2V9K8 | 80-206 | None |
| A0A077Z8D0 | 283-413 | None |
| A0A287JRE3 | 81-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.