DPCstruct | MC54290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 136 ± 8 aa |
| Standard deviation of domain lengths | 8.44 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 64.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565BJP2 | 2-122 | WGADTIMDLSTGRHIPETREWILRNSAVPVGTIPIYQALEKVDGIAEDLSWEVFKETLIEQAEQAKRMTGIVSRGGSIHAKWCLTYH… |
| A0A0B8PDZ4 | 2-123 | IIRNSPVPIGTVPIYQALEKVNGIAEDLNWEIFRDTLIEQAEQGVDYFTIHAGVLLRFVPMTAKRLTGIVSRGGSIMAKWCLSHHKE… |
| A0A800CXV0 | 10-152 | None |
| A0A7C3ZFD7 | 82-222 | None |
| A0A4Y6UBA1 | 198-340 | None |
| A0A855HM57 | 201-321 | None |
| A0A2R7QBU0 | 244-386 | None |
| A0A1B0C474 | 263-405 | None |
| E1ZK53 | 149-285 | None |
| A0A0K2R3X6 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.