DPCstruct | MC5429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 105 ± 12 aa |
| Standard deviation of domain lengths | 12.27 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21359 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453EM81 | 3-92 | HDRAKAVDILVKDLKVFSTFNEELYKEITQLLTLENFRENEQLSKYGDTKSARSIMLIELKKLIEANPLFREKLVFPTLKASRLRTL… |
| A0A1Q3AYA1 | 1-107 | MLFEMRKQKYLEALDNSDRVKALDILMTGLKEFFSDDDHVFRGLTLLLSVNDFRQNELFSTYTDAKSARTNLMTKLKNLIAVNCLLR… |
| A0A540K8F0 | 46-140 | None |
| A0A5D2FQT6 | 46-133 | None |
| A0A565BUM6 | 4-108 | None |
| A0A068UJF0 | 56-175 | None |
| A0A068UIW9 | 47-165 | None |
| A0A5P1FKU5 | 70-184 | None |
| A0A1S8ADX0 | 47-148 | None |
| A0A6N2KAN8 | 84-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.