DPCstruct | MC54289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 132 ± 27 aa |
| Standard deviation of domain lengths | 26.78 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 53.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565BDT1 | 3-124 | SPYIFSGKSIHEARMHFMHAHTLPSLAKNMARFSLILSKTKMLDVYRTGINFKIINDIHCHDQHGYVVVDKNKKPCIHSDGTGYISE… |
| J3KXC3 | 138-246 | SSVRCYFVRTESRWNMDEPYILSGKTIGQARGLFMHIHTALTLPKYMSRFALIVSKTITLDVDLSAVRVELIDDEPCLDEHRNFVFR… |
| A0A0K9QL26 | 297-426 | None |
| A0A453EDL7 | 18-139 | None |
| M0ZHN9 | 386-516 | None |
| A0A287KIP0 | 467-601 | None |
| A0A287KIR8 | 476-594 | None |
| A0A287KIK4 | 171-278 | None |
| A0A5N5MC95 | 87-214 | None |
| A0A2G2YZY4 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.