DPCstruct | MC54287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 124 ± 27 aa |
| Standard deviation of domain lengths | 26.78 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.28 |
| Pfam Score | 99.28 |
| Assigned Pfam label(s) | CL0378- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565AP92 | 8-116 | TVLEELTSNAKQIQDDVLTEILKANANTEYLRGFLHGSFDTDLFKNNVPVVTYEDFKPYIDRVMNGEPSDIISGNPITRFFPSSGIS… |
| A0A081D6F9 | 16-99 | KRIHDMELFMKHPQELQNNLLMDMIRFARHTEVGKKYGFADMKSYRDFADRVPLGNYNDVQDDIERCKNGENNILWPTPIKWFA |
| A0A396I3J6 | 20-118 | None |
| A0A820D7B7 | 25-216 | None |
| A0A0E0HFF0 | 15-123 | None |
| A0A0E0H992 | 11-182 | None |
| A0A2G8L858 | 102-234 | None |
| A0A0D3CP03 | 8-113 | None |
| A0A0D3C937 | 12-132 | None |
| A0A0D9XSM3 | 30-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.