DPCstruct | MC5428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820HYI3 | 6-70 | SRYNKIYEFNYQIFNQKVQMSFTSVSGHIMNCDFTAAHNSWAQVDPVVLFDAPVQKRVTDRATDI |
| A0A1Q3AT90 | 1-66 | MSTRRGSTEIHEFDGKFLGYHVHYKVTSVIGHVFSVDFPAKYQDWKVTNPLDLFLAPILKTESNPK |
| A0A815AX64 | 27-105 | None |
| A0A0N1IGG6 | 27-97 | None |
| A0A812JUV4 | 398-465 | None |
| A0A0D8XLH1 | 44-111 | None |
| A0A6I9YV04 | 10-78 | None |
| A0A7J6RBY3 | 2-67 | None |
| A0A1Y3BQZ6 | 25-98 | None |
| A0A183CS17 | 26-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.