DPCstruct | MC54278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 254 ± 45 aa |
| Standard deviation of domain lengths | 44.65 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1YD44 | 80-340 | LLWNDAKSYGFALWINNEDTFKRQMELIGKSHYMAKEDKDPVESTIYYLALKKVKLLHSLWKNVSYHKEKPAMVKFLANDFTEPRWQ… |
| A0A4R8PUT0 | 18-263 | RNALLAQFENVARNEYTKSDIKNPVNCSLYYLALKKKTVLQGLWRIASWNPEQAATQRLLANDFDDPKWRTVALKNAYALLSKRRFE… |
| A0A821UDT1 | 483-727 | None |
| R4XFY4 | 834-1099 | None |
| A0A3P7FPV9 | 21-306 | None |
| A0A418B7B5 | 150-472 | None |
| A0A2N5V3V3 | 23-235 | None |
| A0A7R9AWJ0 | 821-999 | None |
| A0A1U7QYA6 | 93-293 | None |
| A0A4P9Y7P3 | 14-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.