DPCstruct | MC54275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 256 ± 56 aa |
| Standard deviation of domain lengths | 56.29 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.62 |
| Pfam Score | 86.68 |
| Assigned Pfam label(s) | CL0205- CL0159- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5AR52 | 383-628 | QYYGRLAATRYPQDITAHRAEVVLSNLVVRLQDRSSPHYLDGHITTFLGPPAVNFMESKAKLGHEPYEWNVQVKSCRRSPPSKENPQ… |
| A0A1I8MMV7 | 263-526 | LENPITEILLRQIVITLDGQIQKLLDKRNVDDILYNDVSINNLRVDELKTIVEEVRIGKQSGRLLQLNHKPFSLTLDVNSKRPQDVV… |
| A0A226ELQ5 | 313-579 | None |
| A0A1D2N840 | 9-281 | None |
| A0A482WS29 | 464-841 | None |
| A0A653CLW6 | 4-149 | None |
| A0A7J6ZUB9 | 386-654 | None |
| A0A6P9AGK8 | 610-892 | None |
| A0A226EMK4 | 423-721 | None |
| A0A397UAN0 | 180-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.