DPCstruct | MC5427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 47 ± 1 aa |
| Standard deviation of domain lengths | 0.98 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 76.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 71.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13259 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3AQX2 | 1-47 | MPREPIMSWTTTYEELLCSTEPFNQPIPLAEMVDFLVDIWQEEGLYD |
| A0A0V0H0P2 | 64-110 | MPKDPIISWTTTYEELLSTTDPFSERIPLTEMVDFLVDIWHDEGLFD |
| A0A438D9T1 | 1-48 | None |
| A0A6G1E8W1 | 79-125 | None |
| A0A453EBK3 | 199-243 | None |
| A0A453NRA4 | 25-70 | None |
| A0A287E9M3 | 116-160 | None |
| A0A0R0JI82 | 61-107 | None |
| A0A398AGN1 | 145-190 | None |
| A0A4D8YAI8 | 98-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.